Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 32-194
Amino Acid Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Background: KGF is a member of the family of fibroblast growth factors, it is secreted in large amounts by fibroblast-like stromal cells in epithelial tissues. The KGF receptor encodes a tyrosine kinase and is a member of the family of receptors binding aFGF and bFGF. Binding of KGF to its receptor is competed by aFGF and bFGF. Although KGF is a potent specific mitogen for many epithelial cells, it is not so for fibroblasts and endothelial cells. KGF is thought to play an important role in the paracrine growth control of normal epithelial cells. KGF stimulates the proliferation of primary and secondary human keratinocytes to the same extent as EGF.
Biological Activity: The ED50 was determined by the dose-dependent proliferation of BAF3 cells to be less than 10 ng/ml.
Description: Recombinant human Keratinocyte Growth Factor is a disulfide-linked monomeric protein consisting of 164 amino acid residues. Optimized DNA sequence encoding Human Keratinocyte Growth Factor mature chain was expressed in E. coli. Native human KGF is generated by the proteolytic removal of the signal peptide and propeptide. KGF migrates as an approximately 19 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered 20 mM Phosphate buffer, 1M NaCl, pH 8.0.
Genbank: P21781
Purity: ≥96% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P21781
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Anticancer Res, Aug 2009, 29: 3417 - 3420.
2. Anticancer Res, Aug 2009, 29: 3195 - 3205.
3. Am. J. Respir. Cell Mol. Biol., Feb 2008, 38: 239 - 246.