Human Stromal Cell-Derived Factor-1 beta Recombinant

Human Stromal Cell-Derived Factor-1 beta Recombinant
Artikelnummer
BPS90238-A
Verpackungseinheit
2 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 22-93

Amino Acid Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Background: SDF-1alpha and SDF-1beta are small cytokines belonging to the CXC- Chemokines. SDF-1 is identical with a chemokine reported to function as a pre-B-cell growth factor in the presence of IL-7 and isolated originally from a murine bone marrow stromal cell line. Human SDF-1alpha and SDF-1beta are encoded by a single gene and arise by alternative splicing. SDF-1 acts on lymphocytes and monocytes but not neutrophils in vitro and is a highly potent chemoattractant for mononuclear cells in vivo. In addition, SDF-1 also induces intracellular actin polymerization in lymphocytes. SDF acts as a chemoattractant for human hematopoietic progenitor cells expressing CD34 giving rise to mixed types of progenitors, and more primitive types. The chemotactic response is inhibited by pertussis toxin. Chemotaxis of CD34(+) cells in response to SDF is increased by IL-3 in vitro. SDF has been shown also to induce a transient elevation of cytoplasmic calcium in these cells.

Biological Activity: Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 at a range of 5-40 ng/ml.

Description: Recombinant human stromal cell-derived factor-1β (SDF1β), also known as CXCL12 or Pre-B cell growth-stimulating factor (PBSF), is a disulfide-linked monomeric protein consisting of 73 a.a. and migrates as an approximately 8 kDa protein under reducing and non-reducing conditions. Optimized DNA sequence encoding human SDF1β mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered solution (1 mg/ml) containing 20 mM phosphate buffer, pH 7.0, and 150 mM NaCl.

Genbank: P48061

Purity: ≥97% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Tags:

Uniprot: P48061

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Shirozu, M., et al. (1995). Genomics 28(3):495-500.
2. Nair, S., Schilling, T.F. (2008). Science 322(5898):89-92.
Mehr Informationen
Artikelnummer BPS90238-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90238-A
Verpackungseinheit 2 µg
Mengeneinheit STK
Wirt Escherichia Coli
Produktinformation (PDF)
×
MSDS (PDF)
×