Human TARC(CCL17) Recombinant

Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 24-94

Amino Acid Sequence: RGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Background: Thymus and activation-regulated chemokine (TARC) is a recently identified CC chemokine that is expressed constitutively in thymus and transiently in stimulated peripheral blood mononuclear cells. TARC functions as a selective chemoattractant for T-cells that express a class of high affinity receptors binding TARC. The chemokine TARC is a ligand for the chemokine receptor CCR4 expressed on T helper (Th)2- type CD4 T cells.

Biological Activity: Determined by its ability to chemoattract human T cells using a concentration range of 2.0-40.0 ng/ml.

Description: Recombinant TARC (CCL17) is a disulfide-linked monomeric protein consisting of 72 amino acid residues and migrates as an approximately 8 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human TARC (CCL17) mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, 100 mM NaCl solution, pH 7.5.

Genbank: Q92583

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: Q92583

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Saeki H, Tamaki K. J Dermatol Sci. 2006 Aug,43(2):75-84.
2. Biragyn A, et al. J Immunother. 2013 May,36(4):258-67.

• Artikelnummer: BPS90241-B
• Hersteller: BPS Bioscience
• Hersteller Artikelnummer: 90241-B
• Verpackungseinheit: 20 µg
• Mengeneinheit: STK