Human Thrombopoietin Recombinant

Human Thrombopoietin Recombinant
Artikelnummer
BPS90249-B
Verpackungseinheit
10 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 22-353

Amino Acid Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Background: Thrombopoietin (TPO), known also as TSF (thrombopoiesis stimulating factor), for mediator substances that function as natural stimulators of megakaryocytopoiesis and thus, promote the differentiation of platelets. TPO stimulates an increase in the sizes and numbers of megakaryocytes. It also increases the number of small acetyl-cholinesterase positive cells that are early precursor cells of the megakaryocytic lineage. TPO is a protein of 332 amino acids that shows significant homology with Epo (erythropoietin) in its N-terminal domain. A comparison of human and porcine TPO sequences shows 83 % identity between the erythropoietin-like domains but only 67 % between the C- terminal domains.

Biological Activity: The ED50 was determined by the dose-dependent proliferation of Mo7e cells to be in the range of 1.0-2.0 ng/ml.

Description: Recombinant TPO is disulfide-linked monomer protein consisting of 332 amino acid residues, and migrates due to glycosylation as an approximately 80 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human TPO erythropoeitin domain was expressed in Chinese Hamster Ovary cells.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.

Genbank: P40225

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P07202

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Lupia E, et al. Mediators Inflamm. 2012,2012:390892.
2. Basciano PA, Bussel JB. Curr Opin Hematol. 2012 Sep,19(5):392-8.
3. de Graaf CA, Metcalf D. Cell Cycle. 2011 May 15,10(10):1582-9.
Mehr Informationen
Artikelnummer BPS90249-B
Hersteller BPS Bioscience
Hersteller Artikelnummer 90249-B
Verpackungseinheit 10 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×