Human Thymic stromal lymphopoietin Recombinant

Human Thymic stromal lymphopoietin Recombinant
Artikelnummer
BPS90250-A
Verpackungseinheit
2 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 29-159

Amino Acid Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Background: Thymic stromal lymphopoietin (TSLP) promotes the growth and activation of B cells. It also has wide-ranging impacts on both hematopoietic and nonhematopoietic cell lineages, including dendritic cells, basophils, eosinophils, mast cells, CD4?, CD8? and natural killer T cells, and epithelial cells. TSLP plays a role in the promotion of TH2 responses in lung- and skin-specific allergic disorders, and it also is involved in the blockade of TH1/TH17 responses and the promotion of cancer and autoimmunity.

Biological Activity: The ED50 was determined by the dose-dependent proliferation of human IL-7Rα and human TSLP R co-transfected mouse BaF3 cells to be < 3.0 ng/ml.

Description: Recombinant TSLP is a disulfide-linked monomeric protein consisting of 132 amino acid residues, and migrates as an approximately 15 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human TSLP mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered 1 mg/ml solution of 20 mM phosphate buffer, pH 7.4, 150 mM NaCl.

Genbank: Q969D9

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: Q969D9

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Ziegler SF, et al. Adv Pharmacol. 2013,66:129-55.
2. Yu X, et al. Cell Immunol. 2012 Oct,279(2):174-9.
3. Roan F, et al. J Leukoc Biol. 2012 Jun,91(6):877-86.
Mehr Informationen
Artikelnummer BPS90250-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90250-A
Verpackungseinheit 2 µg
Mengeneinheit STK
Wirt Escherichia Coli
Produktinformation (PDF)
×
MSDS (PDF)
×