HYLS1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HYLS1

Key Reference: Mee,L., (2005) Hum. Mol. Genet. 14 (11), 1475-1488

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydrolethalus syndrome protein 1

Protein Size: 299

Purification: Affinity Purified

• Artikelnummer: AVIARP55449_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55449_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 219844
• Wirt: Rabbit