English
IAH1 Antibody - N-terminal region : Biotin
IAH1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54504_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: IAH1 is probable a lipase.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IAH1
Key Reference: N/A
Molecular Weight: 27kDa
Peptide Sequence: Synthetic peptide located within the following region: TQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Isoamyl acetate-hydrolyzing esterase 1 homolog
Protein Size: 248
Purification: Affinity purified
Description of Target: IAH1 is probable a lipase.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IAH1
Key Reference: N/A
Molecular Weight: 27kDa
Peptide Sequence: Synthetic peptide located within the following region: TQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Isoamyl acetate-hydrolyzing esterase 1 homolog
Protein Size: 248
Purification: Affinity purified
| Artikelnummer | AVIARP54504_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54504_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 285148 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
