ICAM1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ICAM1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Intercellular adhesion molecule 1

Protein Size: 532

Purification: Affinity Purified

• Artikelnummer: AVIARP59129_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59129_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3383
• Wirt: Rabbit
• Konjugat: Conjugated, HRP