IFNA5 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFNA5

Key Reference: Janssen,R., (2007) J. Infect. Dis. 196 (6), 826-834

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon alpha-5

Protein Size: 189

Purification: Affinity Purified

• Artikelnummer: AVIARP54652_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54652_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3442
• Wirt: Rabbit