IFNA8 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: IFNA8 is produced by macrophages, IFN-alpha have antiviral activities. It is a interferon which stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNA8

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon alpha-8

Protein Size: 189

Purification: Affinity Purified

• Artikelnummer: AVIARP54654_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54654_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3445
• Wirt: Rabbit