IFRD1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFRD1

Key Reference: Batta,K. (2007) Mol. Cell. Biol. 27 (21), 7603-7614

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon-related developmental regulator 1

Protein Size: 451

Purification: Affinity Purified

• Artikelnummer: AVIARP54584_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54584_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3475
• Wirt: Rabbit