IGF2BP1 Antibody - N-terminal region : Biotin

IGF2BP1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58386_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1

Key Reference: Palmer,N.D., (2008) Diabetes 57 (4), 1093-1100

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Insulin-like growth factor 2 mRNA-binding protein 1

Protein Size: 577

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58386_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58386_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 10642
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×