IL17A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL17A

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-17A

Protein Size: 155

Purification: Affinity Purified

• Artikelnummer: AVIARP59132_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59132_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3605
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin