ILDR1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ILDR1 is a putative membrane receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ILDR1

Key Reference: Hauge,H., (2004) Biochem. Biophys. Res. Commun. 323 (3), 970-978

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Immunoglobulin-like domain-containing receptor 1

Protein Size: 502

Purification: Affinity Purified

• Artikelnummer: AVIARP55751_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55751_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 286676
• Wirt: Rabbit