IMPA1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IMPA1

Key Reference: Ohnishi,T., (2007) J. Biol. Chem. 282 (1), 637-646

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol monophosphatase 1

Protein Size: 277

Purification: Affinity Purified

• Artikelnummer: AVIARP58713_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58713_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3612
• Wirt: Rabbit
• Konjugat: Conjugated, FITC