IMPA2 Antibody - middle region : HRP

IMPA2 Antibody - middle region : HRP
Artikelnummer
AVIARP58229_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IMPA2

Key Reference: Ohnishi,T., (2007) Neuropsychopharmacology 32 (8), 1727-1737

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Inositol monophosphatase 2

Protein Size: 288

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58229_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58229_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3613
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×