English
IPP Antibody - C-terminal region : Biotin
IPP Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54790_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.The protein encoded by this gene is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin. Transcript variants have been described but their full-length nature has not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IPP
Key Reference: VanHouten,J.N., (2001) Oncogene 20 (38), 5366-5372
Molecular Weight: 65kDa
Peptide Sequence: Synthetic peptide located within the following region: EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Actin-binding protein IPP
Protein Size: 584
Purification: Affinity Purified
Description of Target: IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.The protein encoded by this gene is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin. Transcript variants have been described but their full-length nature has not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IPP
Key Reference: VanHouten,J.N., (2001) Oncogene 20 (38), 5366-5372
Molecular Weight: 65kDa
Peptide Sequence: Synthetic peptide located within the following region: EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Actin-binding protein IPP
Protein Size: 584
Purification: Affinity Purified
| Artikelnummer | AVIARP54790_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54790_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 3652 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
