ISG20 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ISG20

Molecular Weight: 19 kDa

Peptide Sequence: Synthetic peptide located within the following region: STDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATME

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: interferon-stimulated gene 20 kDa protein

Protein Size: 181

Purification: Affinity purified

• Artikelnummer: AVIARP59089_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59089_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3669
• Wirt: Rabbit
• Konjugat: Conjugated, HRP