Itgb1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Integrin beta-1

Protein Size: 798

Purification: Affinity Purified

• Artikelnummer: AVIARP58832_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58832_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 16412
• Wirt: Rabbit
• Konjugat: Conjugated, HRP