ITIH1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is the heavy chain of a serine protease inhibitor that may serve to carry hyaluronan in plasma. This gene is part of a cluster of similar genes on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ITIH1

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: VSDIHPGSDPTKPDATMVVRNRRLTVTRGLQKDYSKDPWHGAEVSCWFIH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ51523, highly similar to Inter-alpha-trypsin inhibitor heavy chain H1 EMBL BAH12794.1

Protein Size: 769

Purification: Affinity Purified

• Artikelnummer: AVIARP59204_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59204_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3697
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin