IVD Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IVD

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isovaleryl-CoA dehydrogenase, mitochondrial

Protein Size: 423

Purification: Affinity Purified

• Artikelnummer: AVIARP58485_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58485_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3712
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin