IZUMO1R Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOLR4

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: sperm-egg fusion protein Juno

Protein Size: 243

Purification: Affinity Purified

• Artikelnummer: AVIARP59117_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59117_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 390243
• Wirt: Rabbit
• Konjugat: Conjugated, HRP