JARID2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human JARID2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 139kDa

Peptide Sequence: Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Jumonji

Protein Size: 1246

Purification: Affinity Purified

• Artikelnummer: AVIARP58842_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58842_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3720
• Wirt: Rabbit
• Konjugat: Conjugated, HRP