KANK1 Antibody - C-terminal region : FITC

KANK1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55572_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains. This family member functions in cytoskeleton formation by regulating actin polymerization. This gene is a candidate tumor suppressor for renal cell carcinoma. Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder. A t(5;9) translocation results in fusion of the platelet-derived growth factor receptor beta gene (PDGFRB) on chromosome 5 with this gene in a myeloproliferative neoplasm featuring severe thrombocythemia. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 20.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human KANK1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: STALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: KN motif and ankyrin repeat domain-containing protein 1

Protein Size: 330

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55572_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55572_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23189
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×