KIAA0892 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0892

Key Reference: Seitan,V.C., PLoS Biol. 4 (8), E242 (2006)

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAU2 chromatid cohesion factor homolog

Protein Size: 613

Purification: Affinity Purified

Subunit: SCC4 homolog

• Artikelnummer: AVIARP55232_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55232_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23383
• Wirt: Rabbit