KIAA0930 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930

Key Reference: N/A

Molecular Weight: 40 kDa

Peptide Sequence: Synthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein KIAA0930

Protein Size: 370

Purification: Affinity purified

• Artikelnummer: AVIARP55214_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55214_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23313
• Wirt: Rabbit