KIAA1191 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1191

Key Reference: Zuhlke,C., (1999) DNA Seq. 10 (1), 1-6

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative monooxygenase p33MONOX

Protein Size: 305

Purification: Affinity Purified

• Artikelnummer: AVIARP56290_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56290_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57179
• Wirt: Rabbit