KLF8 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8

Key Reference: Wang,X., (2007) Cancer Res. 67 (15), 7184-7193

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Krueppel-like factor 8

Protein Size: 359

Purification: Affinity Purified

• Artikelnummer: AVIARP57952_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57952_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11279
• Wirt: Rabbit