KLHL15 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL15

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 15

Protein Size: 604

Purification: Affinity Purified

• Artikelnummer: AVIARP58487_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58487_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 80311
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin