KLHL15 Antibody - middle region : FITC

KLHL15 Antibody - middle region : FITC
Artikelnummer
AVIARP58487_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL15

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 15

Protein Size: 604

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58487_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58487_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 80311
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×