Klkbl4 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Klkbl4 is a secreted protein. Klkbl4 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Klkbl4

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inactive serine protease 54

Protein Size: 395

Purification: Affinity Purified

• Artikelnummer: AVIARP54527_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54527_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 221191
• Wirt: Rabbit