English
KNG1 Antibody - N-terminal region : FITC
KNG1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP59203_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1
Molecular Weight: 43kDa
Peptide Sequence: Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Kininogen-1 Ensembl ENSP00000396025
Protein Size: 391
Purification: Affinity Purified
Description of Target: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1
Molecular Weight: 43kDa
Peptide Sequence: Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Kininogen-1 Ensembl ENSP00000396025
Protein Size: 391
Purification: Affinity Purified
| Artikelnummer | AVIARP59203_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP59203_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Pig (Porcine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 3827 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
