KNG1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kininogen-1 Ensembl ENSP00000396025

Protein Size: 391

Purification: Affinity Purified

• Artikelnummer: AVIARP59203_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59203_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3827
• Wirt: Rabbit
• Konjugat: Conjugated, FITC