KPTN Antibody - N-terminal region : HRP

KPTN Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58488_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KPTN

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kaptin

Protein Size: 436

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58488_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58488_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11133
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×