KRT75 Antibody - middle region : FITC

KRT75 Antibody - middle region : FITC
Artikelnummer
AVIARP58769_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT75

Key Reference: Schweizer,J., (2006) J. Cell Biol. 174 (2), 169-174

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Keratin, type II cytoskeletal 75

Protein Size: 551

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58769_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58769_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9119
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×