KRT75 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRT75

Key Reference: Schweizer,J., (2006) J. Cell Biol. 174 (2), 169-174

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Keratin, type II cytoskeletal 75

Protein Size: 551

Purification: Affinity Purified

• Artikelnummer: AVIARP58768_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58768_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 9119
• Wirt: Rabbit
• Konjugat: Conjugated, FITC