LAG3 Antibody - C-terminal region : Biotin

LAG3 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP59142_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAG3

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: GFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lymphocyte activation gene 3 protein

Protein Size: 525

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59142_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59142_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3902
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×