LAG3 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAG3

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: GFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lymphocyte activation gene 3 protein

Protein Size: 525

Purification: Affinity Purified

• Artikelnummer: AVIARP59142_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59142_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Yeast
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3902
• Wirt: Rabbit
• Konjugat: Conjugated, HRP