LANCL2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LANCL2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LanC-like protein 2

Protein Size: 450

Purification: Affinity Purified

• Artikelnummer: AVIARP57286_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57286_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55915
• Wirt: Rabbit