LAP3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAP3

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosol aminopeptidase

Protein Size: 519

Purification: Affinity Purified

• Artikelnummer: AVIARP56769_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56769_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51056
• Wirt: Rabbit