LAX1 Antibody - C-terminal region : Biotin

LAX1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP59140_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAX1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ55255, highly similar to Lymphocyte transmembrane adapter 1 EMBL BAH13480.1

Protein Size: 382

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59140_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59140_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54900
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×