LAX1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAX1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ55255, highly similar to Lymphocyte transmembrane adapter 1 EMBL BAH13480.1

Protein Size: 382

Purification: Affinity Purified

• Artikelnummer: AVIARP59140_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59140_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54900
• Wirt: Rabbit
• Konjugat: Conjugated, FITC