LCN12 Antibody - N-terminal region : FITC

LCN12 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58489_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12

Key Reference: Suzuki,K., Gene 339, 49-59 (2004)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LCN12 protein EMBL AAH41168.1

Protein Size: 355

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58489_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58489_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286256
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×