English
LCN8 Antibody - N-terminal region : Biotin
LCN8 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58490_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The exact function of LCN8 is not known.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN8
Key Reference: Suzuki,K., Gene 339, 49-59 (2004)
Molecular Weight: 17kDa
Peptide Sequence: Synthetic peptide located within the following region: EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Epididymal-specific lipocalin-8
Protein Size: 152
Purification: Affinity Purified
Description of Target: The exact function of LCN8 is not known.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN8
Key Reference: Suzuki,K., Gene 339, 49-59 (2004)
Molecular Weight: 17kDa
Peptide Sequence: Synthetic peptide located within the following region: EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Epididymal-specific lipocalin-8
Protein Size: 152
Purification: Affinity Purified
| Artikelnummer | AVIARP58490_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58490_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 138307 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
