LGALS1 Antibody - middle region : Biotin

LGALS1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58491_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS1

Key Reference: Bi,S., (2008) J. Biol. Chem. 283 (18), 12248-12258

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-1

Protein Size: 135

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58491_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58491_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 3956
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×