Lhpp Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lhpp is a phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. It has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Lhpp

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Protein Size: 270

Purification: Affinity Purified

• Artikelnummer: AVIARP57606_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57606_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 76429
• Wirt: Rabbit