Calculated MW: 42
Form: Liquid
Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety to apoproteins. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 13. Read-through transcription also exists between this gene and the neighboring downstream mitochondrial ribosomal protein L30 (MRPL30) gene. [provided by RefSeq, Mar 2011]
Uniprot ID: Q9Y234
Antigen Species: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LIPT protein: RALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCST
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
Full Name: lipoyltransferase 1