LIPT1 antibody

LIPT1 antibody
Artikelnummer
GTX04598-100
Verpackungseinheit
100 μl
Hersteller
GeneTex

Verfügbarkeit: wird geladen...
Preis wird geladen...
Calculated MW: 42

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety to apoproteins. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 13. Read-through transcription also exists between this gene and the neighboring downstream mitochondrial ribosomal protein L30 (MRPL30) gene. [provided by RefSeq, Mar 2011]

Uniprot ID: Q9Y234

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIPT1 protein: NDVYQNLAVEDWIHDHMNLEGKPILFFWQNSPSVVIGRHQNPWQECNLNL

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: lipoyltransferase 1
Mehr Informationen
Artikelnummer GTX04598-100
Hersteller GeneTex
Hersteller Artikelnummer GTX04598-100
Green Labware Nein
Verpackungseinheit 100 μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Isotyp IgG
Human Gene ID 51601
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×