LOC100362453 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 309

Purification: Affinity Purified

Subunit: alpha-like

• Artikelnummer: AVIARP56187_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56187_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 100362453
• Wirt: Rabbit