LOH11CR2A Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LOH11CR2A may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOH11CR2A

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: TLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: von Willebrand factor A domain-containing protein 5A

Protein Size: 786

Purification: Affinity Purified

• Artikelnummer: AVIARP55093_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55093_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4013
• Wirt: Rabbit