LRP1 Antibody - middle region : HRP

LRP1 Antibody - middle region : HRP
Artikelnummer
AVIARP58562_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prolow-density lipoprotein receptor-related protein 1

Protein Size: 439

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58562_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58562_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 4035
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×